Lineage for d5i66a_ (5i66 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (23 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. 2744315Domain d5i66a_: 5i66 A: [410162]
    Other proteins in same PDB: d5i66b1, d5i66b2
    automated match to d6shgh_

Details for d5i66a_

PDB Entry: 5i66 (more details), 1.62 Å

PDB Description: x-ray structure of the fab fragment of 8b6, a murine monoclonal antibody specific for the human serotonin transporter
PDB Compounds: (A:) 8B6 antibody, heavy chain

SCOPe Domain Sequences for d5i66a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i66a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgasvkisckasgytftdyymnwvkqshgkslewigninpnnggtsy
nqkfkgkatltvdkssttaymelrsltsedsavyyctrspvrpyyfdywgqgttltvssa
kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
ytmsssvtvpsstwpsqtvtcsvahpassttvdkklep

SCOPe Domain Coordinates for d5i66a_:

Click to download the PDB-style file with coordinates for d5i66a_.
(The format of our PDB-style files is described here.)

Timeline for d5i66a_:

  • d5i66a_ is new in SCOPe 2.08-stable