Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5i16h_: 5i16 H: [410144] Other proteins in same PDB: d5i16a1, d5i16a2, d5i16l1, d5i16l2 automated match to d6shgh_ complexed with gol, mes |
PDB Entry: 5i16 (more details), 1.9 Å
SCOPe Domain Sequences for d5i16h_:
Sequence, based on SEQRES records: (download)
>d5i16h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany aqkfqgrvtitadeststaymelsslrsedtavyycarydgiygeldfwgqgtlvtvssa stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
>d5i16h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany aqkfqgrvtitadeststaymelsslrsedtavyycarydgiygeldfwgqgtlvtvssa stkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls svvtvpssslgtqtyicnvnhkpsntkvdkkvep
Timeline for d5i16h_: