Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d5hysh_: 5hys H: [410141] Other proteins in same PDB: d5hysb1, d5hysb2, d5hysd1, d5hysd2, d5hysf1, d5hysf2, d5hysg1, d5hysg2, d5hysi1, d5hysi2, d5hysj1, d5hysj2, d5hysk1, d5hysk2, d5hysl1, d5hysl2 automated match to d6shgh_ complexed with so4 |
PDB Entry: 5hys (more details), 2.5 Å
SCOPe Domain Sequences for d5hysh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hysh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlscavsgysitsgyswnwirqapgkglewvasitydgstny npsvkgritisrddskntfylqmnslraedtavyycargshyfghwhfavwgqgtlvtvs sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d5hysh_: