Lineage for d5hysh_ (5hys H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742742Domain d5hysh_: 5hys H: [410141]
    Other proteins in same PDB: d5hysb1, d5hysb2, d5hysd1, d5hysd2, d5hysf1, d5hysf2, d5hysg1, d5hysg2, d5hysi1, d5hysi2, d5hysj1, d5hysj2, d5hysk1, d5hysk2, d5hysl1, d5hysl2
    automated match to d6shgh_
    complexed with so4

Details for d5hysh_

PDB Entry: 5hys (more details), 2.5 Å

PDB Description: structure of ige complexed with omalizumab
PDB Compounds: (H:) Epididymis luminal protein 214

SCOPe Domain Sequences for d5hysh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hysh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscavsgysitsgyswnwirqapgkglewvasitydgstny
npsvkgritisrddskntfylqmnslraedtavyycargshyfghwhfavwgqgtlvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d5hysh_:

Click to download the PDB-style file with coordinates for d5hysh_.
(The format of our PDB-style files is described here.)

Timeline for d5hysh_:

  • d5hysh_ is new in SCOPe 2.08-stable