Lineage for d5gzoc1 (5gzo C:6-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (30 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. 2758861Domain d5gzoc1: 5gzo C:6-219 [410121]
    Other proteins in same PDB: d5gzoa1, d5gzoa2, d5gzob1, d5gzob2, d5gzoc2, d5gzoh2
    automated match to d6shgh_

Details for d5gzoc1

PDB Entry: 5gzo (more details), 2.76 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein
PDB Compounds: (C:) antibody heavy chain

SCOPe Domain Sequences for d5gzoc1:

Sequence, based on SEQRES records: (download)

>d5gzoc1 b.1.1.0 (C:6-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsgtlsltcavsggsisssnwwswvrqppgkglewigeiyhsgstnynpslk
srvtisvdksknqfslklssvtaadtavyycardrddlspfdywgqgtlvtvssastkgp
svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d5gzoc1 b.1.1.0 (C:6-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsgtlsltcavsggsisssnwwswvrqppgkglewigeiyhsgstnynpslk
srvtisvdksknqfslklssvtaadtavyycardrddlspfdywgqgtlvtvssastkgp
svfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtv
pssslgtqtyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d5gzoc1:

Click to download the PDB-style file with coordinates for d5gzoc1.
(The format of our PDB-style files is described here.)

Timeline for d5gzoc1:

  • d5gzoc1 is new in SCOPe 2.08-stable