SCOP 1.73: Domain d1tvua_: 1tvu A:

Lineage for d1tvua_ (1tvu A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family)

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Lactobacillus casei [TaxId:1582] [55835] (39 PDB entries)

8. Domain d1tvua_: 1tvu A: [41012]
   complexed with cb3, ump; mutant

Details for d1tvua_

PDB Entry: 1tvu, 2.5 Å

PDB Description: contributions of orientation and hydrogen bonding to catalysis in asn- 229 mutants of thymidylate synthase

PDB Compounds: (A:) Thymidylate synthase

SCOP Domain Sequences for d1tvua_:

Sequence; same for both SEQRES and ATOM records:

>d1tvua_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfaiasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

Timeline for d1tvua_:

• d1tvua_ first appeared (with stable ids) in SCOP 1.55, called d1tvu__
  
• d1tvua_ was called d1tvu__ in SCOP 1.71
  
• d1tvua_ appears in SCOP 1.75
  
• d1tvua_ appears in the current release, SCOPe 2.08