SCOPe 2.07: Domain d2tdma_: 2tdm A:

Lineage for d2tdma_ (2tdm A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Lactobacillus casei [TaxId:1582] [55835] (51 PDB entries)

8. Domain d2tdma_: 2tdm A: [41011]
   complexed with ump

Details for d2tdma_

PDB Entry: 2tdm, 2.55 Å

PDB Description: structure of thymidylate synthase

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d2tdma_:

Sequence; same for both SEQRES and ATOM records:

>d2tdma_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

Timeline for d2tdma_:

• d2tdma_ first appeared (with stable ids) in SCOP 1.55, called d2tdm__
  
• d2tdma_ appears in SCOPe 2.06
  
• d2tdma_ appears in the current release, SCOPe 2.08