SCOPe 2.08: Domain d5gksc1: 5gks C:6-213

Lineage for d5gksc1 (5gks C:6-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5gksc1: 5gks C:6-213 [410107]
   Other proteins in same PDB: d5gksa2, d5gksb1, d5gksb2, d5gksc2, d5gksd1, d5gksd2
   automated match to d6shgh_
   complexed with po4

Details for d5gksc1

PDB Entry: 5gks, 2.05 Å

PDB Description: crystal structure of sle patient-derived anti-dna antibody

PDB Compounds: (C:) IgG2, Fab (heavy chain)

SCOPe Domain Sequences for d5gksc1:

Sequence, based on SEQRES records:

>d5gksc1 b.1.1.0 (C:6-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkssetlsltctvsggsissyfwswirqppgkglewigyiyysgstnynpslks
rvtislhtsknqfslklssvtaadtavyycarhrnwlfdywgqgtlvtvssastkgpsvf
plapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvpssslgtqtytcnvdhkpsntkvdktver

Sequence, based on observed residues (ATOM records):

>d5gksc1 b.1.1.0 (C:6-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkssetlsltctvsggsissyfwswirqppgkglewigyiyysgstnynpslks
rvtislhtsknqfslklssvtaadtavyycarhrnwlfdywgqgtlvtvssastkgpsvf
plapaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpstytcn
vdhkpsntkvdktver

Timeline for d5gksc1:

• d5gksc1 is new in SCOPe 2.08-stable