Lineage for d1njca_ (1njc A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732217Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 732218Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 732219Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 732247Protein Thymidylate synthase [55833] (7 species)
  7. 732368Species Lactobacillus casei [TaxId:1582] [55835] (39 PDB entries)
  8. 732382Domain d1njca_: 1njc A: [41005]
    complexed with dcm; mutant

Details for d1njca_

PDB Entry: 1njc (more details), 2.5 Å

PDB Description: thymidylate synthase, mutation, n229d with 2'-deoxycytidine 5'- monophosphate (dcmp)
PDB Compounds: (A:) Thymidylate synthase

SCOP Domain Sequences for d1njca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njca_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfdiasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

SCOP Domain Coordinates for d1njca_:

Click to download the PDB-style file with coordinates for d1njca_.
(The format of our PDB-style files is described here.)

Timeline for d1njca_: