SCOPe 2.05: Domain d1bp6a_: 1bp6 A:

Lineage for d1bp6a_ (1bp6 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Lactobacillus casei [TaxId:1582] [55835] (51 PDB entries)

8. Domain d1bp6a_: 1bp6 A: [41000]
   complexed with k, ump; mutant

Details for d1bp6a_

PDB Entry: 1bp6, 2.4 Å

PDB Description: thymidylate synthase r23i, r179t double mutant

PDB Compounds: (A:) protein (thymidylate synthase)

SCOPe Domain Sequences for d1bp6a_:

Sequence; same for both SEQRES and ATOM records:

>d1bp6a_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdithtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrtl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

Timeline for d1bp6a_:

• d1bp6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1bp6a_ appears in SCOPe 2.04
  
• d1bp6a_ appears in SCOPe 2.06
  
• d1bp6a_ appears in the current release, SCOPe 2.08