Lineage for d5ddba3 (5ddb A:549-586)

  1. Root: SCOPe 2.08
  2. 3048457Class l: Artifacts [310555] (1 fold)
  3. 3048458Fold l.1: Tags [310573] (1 superfamily)
  4. 3048459Superfamily l.1.1: Tags [310607] (1 family) (S)
  5. 3048460Family l.1.1.1: Tags [310682] (2 proteins)
  6. 3048461Protein C-terminal Tags [310895] (1 species)
  7. 3048462Species Synthetic [311502] (6039 PDB entries)
  8. 3049997Domain d5ddba3: 5ddb A:549-586 [409945]
    Other proteins in same PDB: d5ddba1, d5ddba2
    complexed with 59q, dms, peg, pg4, so4

Details for d5ddba3

PDB Entry: 5ddb (more details), 1.54 Å

PDB Description: menin in complex with mi-319
PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d5ddba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ddba3 l.1.1.1 (A:549-586) C-terminal Tags {Synthetic}
pvltfqsekmkgmkellvatkinssaiklqltaqsqvq

SCOPe Domain Coordinates for d5ddba3:

Click to download the PDB-style file with coordinates for d5ddba3.
(The format of our PDB-style files is described here.)

Timeline for d5ddba3:

  • d5ddba3 is new in SCOPe 2.08-stable