Lineage for d1bp0a_ (1bp0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972208Protein Thymidylate synthase [55833] (7 species)
  7. 2972508Species Lactobacillus casei [TaxId:1582] [55835] (51 PDB entries)
  8. 2972515Domain d1bp0a_: 1bp0 A: [40993]
    complexed with k, ump; mutant

Details for d1bp0a_

PDB Entry: 1bp0 (more details), 2.4 Å

PDB Description: thymidylate synthase r23i mutant
PDB Compounds: (A:) protein (thymidylate synthase)

SCOPe Domain Sequences for d1bp0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bp0a_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdithtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

SCOPe Domain Coordinates for d1bp0a_:

Click to download the PDB-style file with coordinates for d1bp0a_.
(The format of our PDB-style files is described here.)

Timeline for d1bp0a_: