Lineage for d5d96c_ (5d96 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744848Domain d5d96c_: 5d96 C: [409920]
    Other proteins in same PDB: d5d96b1, d5d96b2, d5d96i1, d5d96i2
    automated match to d6shgh_

Details for d5d96c_

PDB Entry: 5d96 (more details), 2.3 Å

PDB Description: oxidoreductase fragment of mouse qsox1 in complex with a fab fragment from an antibody targeting mouse and human qsox1
PDB Compounds: (C:) Heavy chain of Fab fragment from an antibody targeting mouse and human QSOX1

SCOPe Domain Sequences for d5d96c_:

Sequence, based on SEQRES records: (download)

>d5d96c_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlkqsgpglvapsqslsitctvsgfsltgysviwvrqspgkglewlgmiwgdgrteyk
salksrlsitkdnsksqvflkmnslqtddtaryfcasdsmdpgsfaywgqgtlvtvssak
ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpsstwpsqtvtcnvahpasstkvdkkivprdc

Sequence, based on observed residues (ATOM records): (download)

>d5d96c_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlkqsgpglvapsqslsitctvsgfsltgysviwvrqspgkglewlgmiwgdgrteyk
salksrlsitkdnsksqvflkmnslqtddtaryfcasdsmdpgsfaywgqgtlvtvssak
ttppsvyplapnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
tvpsstwpsqtvtcnvahpasstkvdkkivprdc

SCOPe Domain Coordinates for d5d96c_:

Click to download the PDB-style file with coordinates for d5d96c_.
(The format of our PDB-style files is described here.)

Timeline for d5d96c_:

  • d5d96c_ is new in SCOPe 2.08-stable