Lineage for d1tsla_ (1tsl A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2579045Species Lactobacillus casei [TaxId:1582] [55835] (51 PDB entries)
  8. 2579053Domain d1tsla_: 1tsl A: [40992]
    complexed with a15, po4

Details for d1tsla_

PDB Entry: 1tsl (more details), 2.5 Å

PDB Description: l. casei thymidylate synthase with species specific inhibitor
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1tsla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tsla_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei [TaxId: 1582]}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

SCOPe Domain Coordinates for d1tsla_:

Click to download the PDB-style file with coordinates for d1tsla_.
(The format of our PDB-style files is described here.)

Timeline for d1tsla_: