Lineage for d1an5b_ (1an5 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578782Species Escherichia coli [TaxId:562] [55834] (71 PDB entries)
  8. 2578876Domain d1an5b_: 1an5 B: [40987]
    complexed with cb3, po4

Details for d1an5b_

PDB Entry: 1an5 (more details), 2.6 Å

PDB Description: e. coli thymidylate synthase in complex with cb3717
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d1an5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1an5b_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d1an5b_:

Click to download the PDB-style file with coordinates for d1an5b_.
(The format of our PDB-style files is described here.)

Timeline for d1an5b_: