SCOPe 2.08: Domain d2kcea_: 2kce A:

Lineage for d2kcea_ (2kce A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (70 PDB entries)

8. Domain d2kcea_: 2kce A: [40984]
   complexed with d16, ump

Details for d2kcea_

PDB Entry: 2kce, 2.2 Å

PDB Description: binding of the anticancer drug zd1694 to e. coli thymidylate synthase: assessing specificity and affinity

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d2kcea_:

Sequence; same for both SEQRES and ATOM records:

>d2kcea_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d2kcea_:

• d2kcea_ first appeared (with stable ids) in SCOP 1.55
  
• d2kcea_ appears in SCOPe 2.07