Lineage for d5bvph_ (5bvp H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742935Domain d5bvph_: 5bvp H: [409833]
    Other proteins in same PDB: d5bvpi_, d5bvpl1, d5bvpl2
    automated match to d6shgh_
    complexed with cl

Details for d5bvph_

PDB Entry: 5bvp (more details), 2.2 Å

PDB Description: the molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing il-1beta
PDB Compounds: (H:) canakinumab Fab heavy-chain

SCOPe Domain Sequences for d5bvph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bvph_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggvvqpgrslrlscaasgftfsvygmnwvrqapgkglewvaiiwydgdnqyy
adsvkgrftisrdnskntlylqmnglraedtavyycardlrtgpfdywgqgtlvtvssas
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepks

SCOPe Domain Coordinates for d5bvph_:

Click to download the PDB-style file with coordinates for d5bvph_.
(The format of our PDB-style files is described here.)

Timeline for d5bvph_:

  • d5bvph_ is new in SCOPe 2.08-stable