SCOPe 2.07: Domain d1tlsb1: 1tls B:2-264

Lineage for d1tlsb1 (1tls B:2-264)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (71 PDB entries)

8. Domain d1tlsb1: 1tls B:2-264 [40983]
   Other proteins in same PDB: d1tlsa2, d1tlsb2
   complexed with c2f, ufp

Details for d1tlsb1

PDB Entry: 1tls, 2.6 Å

PDB Description: thymidylate synthase ternary complex with fdump and methylenetetrahydrofolate

PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d1tlsb1:

Sequence; same for both SEQRES and ATOM records:

>d1tlsb1 d.117.1.1 (B:2-264) Thymidylate synthase {Escherichia coli [TaxId: 562]}
kqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihellw
flqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlkn
dpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfniasy
allvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesifd
yrfedfeiegydphpgikapvai

Timeline for d1tlsb1:

• d1tlsb1 first appeared (with stable ids) in SCOP 1.55, called d1tlsb_
  
• d1tlsb1 appears in SCOPe 2.06
  
• d1tlsb1 appears in the current release, SCOPe 2.08