Lineage for d5bo1i_ (5bo1 I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743325Domain d5bo1i_: 5bo1 I: [409820]
    Other proteins in same PDB: d5bo1l1, d5bo1l2, d5bo1m1, d5bo1m2
    automated match to d6shgh_
    complexed with gol

Details for d5bo1i_

PDB Entry: 5bo1 (more details), 2.56 Å

PDB Description: crystal structure of a human jag1 fragment in complex with an anti- jag1 fab
PDB Compounds: (I:) Fab heavy chain

SCOPe Domain Sequences for d5bo1i_:

Sequence, based on SEQRES records: (download)

>d5bo1i_ b.1.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfsnygihwvrqapgkglewvgwitpdggytdy
adsvkgrftisadtskntaylqmnslraedtavyycaragtlfaywgqgtlvtvssastk
gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records): (download)

>d5bo1i_ b.1.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfsnygihwvrqapgkglewvgwitpdggytdy
adsvkgrftisadtskntaylqmnslraedtavyycaragtlfaywgqgtlvtvssastk
gpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvt
vpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d5bo1i_:

Click to download the PDB-style file with coordinates for d5bo1i_.
(The format of our PDB-style files is described here.)

Timeline for d5bo1i_:

  • d5bo1i_ is new in SCOPe 2.08-stable