Lineage for d1ajm__ (1ajm -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35325Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
  4. 35326Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 35327Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 35339Protein Thymidylate synthase [55833] (7 species)
  7. 35354Species Escherichia coli [TaxId:562] [55834] (39 PDB entries)
  8. 35405Domain d1ajm__: 1ajm - [40981]

Details for d1ajm__

PDB Entry: 1ajm (more details), 2.4 Å

PDB Description: crystal structure of thymidylate synthase r126e mutant

SCOP Domain Sequences for d1ajm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ajm__ d.117.1.1 (-) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdseriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOP Domain Coordinates for d1ajm__:

Click to download the PDB-style file with coordinates for d1ajm__.
(The format of our PDB-style files is described here.)

Timeline for d1ajm__: