Lineage for d1ajm__ (1ajm -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Escherichia coli [TaxId:562] [55834] (39 PDB entries) 
Domain d1ajm__: 1ajm - [40981]
Details for d1ajm__
PDB Entry: 1ajm (more details), 2.4 Å
PDB Description: crystal structure of thymidylate synthase r126e mutant
SCOP Domain Sequences for d1ajm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ajm__ d.117.1.1 (-) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdseriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOP Domain Coordinates for d1ajm__:
Click to download the PDB-style file with coordinates for d1ajm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ajm__:
- d1ajm__ appears in SCOP 1.57
- d1ajm__ appears in the current release, SCOPe 2.08, called d1ajma_
View in 3D