Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d5bk1h_: 5bk1 H: [409806] Other proteins in same PDB: d5bk1a_, d5bk1b_, d5bk1d1, d5bk1d2, d5bk1l1, d5bk1l2 automated match to d6shgh_ complexed with cl, gol |
PDB Entry: 5bk1 (more details), 2.15 Å
SCOPe Domain Sequences for d5bk1h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bk1h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqlvesggglvqpggslrlscaasgfnvyyssihwvrqapgkglewvasiysyygstsya dsvkgrftisadtskntaylqmnslraedtavyycareyhsyvyepplygmdywgqgtlv tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d5bk1h_: