Lineage for d5bk1h_ (5bk1 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742826Domain d5bk1h_: 5bk1 H: [409806]
    Other proteins in same PDB: d5bk1a_, d5bk1b_, d5bk1d1, d5bk1d2, d5bk1l1, d5bk1l2
    automated match to d6shgh_
    complexed with cl, gol

Details for d5bk1h_

PDB Entry: 5bk1 (more details), 2.15 Å

PDB Description: crystal structure of maltose binding protein in complex with an endosteric synthetic antibody
PDB Compounds: (H:) Synthetic antibody, Fab fragment, Heavy Chain

SCOPe Domain Sequences for d5bk1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bk1h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgfnvyyssihwvrqapgkglewvasiysyygstsya
dsvkgrftisadtskntaylqmnslraedtavyycareyhsyvyepplygmdywgqgtlv
tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d5bk1h_:

Click to download the PDB-style file with coordinates for d5bk1h_.
(The format of our PDB-style files is described here.)

Timeline for d5bk1h_:

  • d5bk1h_ is new in SCOPe 2.08-stable