Lineage for d5b6ff_ (5b6f F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744629Domain d5b6ff_: 5b6f F: [409799]
    Other proteins in same PDB: d5b6fa1, d5b6fa2, d5b6fc1, d5b6fc2, d5b6fe1, d5b6fe2, d5b6fg1, d5b6fg2
    automated match to d6shgh_
    complexed with ltx, mes, so4

Details for d5b6ff_

PDB Entry: 5b6f (more details), 2.1 Å

PDB Description: crystal structure of the fab fragment of an anti-leukotriene c4 monoclonal antibody complexed with ltc4
PDB Compounds: (F:) anti-leukotriene C4 monoclonal antibody immunoglobulin gamma1 heavy chain

SCOPe Domain Sequences for d5b6ff_:

Sequence, based on SEQRES records: (download)

>d5b6ff_ b.1.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evkleesggglvqpggsmklscvasgftisnywmnwvrqspekgldwvaeirlksnnyvt
hyaesvkgrftisrddsknsvylqmnnlrpedtgiyyctpiyspfaywgqgtlvtvsaak
ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d5b6ff_ b.1.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evkleesggglvqpggsmklscvasgftisnywmnwvrqspekgldwvaeirlksnnyvt
hyaesvkgrftisrddsknsvylqmnnlrpedtgiyyctpiyspfaywgqgtlvtvsaak
ttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
tvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d5b6ff_:

Click to download the PDB-style file with coordinates for d5b6ff_.
(The format of our PDB-style files is described here.)

Timeline for d5b6ff_:

  • d5b6ff_ is new in SCOPe 2.08-stable