Lineage for d5anmd_ (5anm D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758350Domain d5anmd_: 5anm D: [409784]
    Other proteins in same PDB: d5anma1, d5anma2, d5anmc1, d5anmc2, d5anme1, d5anme2, d5anmf1, d5anmf2, d5anmg1, d5anmg2, d5anml2
    automated match to d6shgh_

Details for d5anmd_

PDB Entry: 5anm (more details), 2.85 Å

PDB Description: crystal structure of ige fc in complex with a neutralizing antibody
PDB Compounds: (D:) immunoglobulin g

SCOPe Domain Sequences for d5anmd_:

Sequence, based on SEQRES records: (download)

>d5anmd_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgatvkisckvygyiftdyniywvrqapgkglewmglidpdngetfy
aekfqgratmtadtssdraymelsslrfedtavyycatvmgkwikggydywgrgtlvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d5anmd_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgatvkisckvygyiftdyniywvrqapgkglewmglidpdngetfy
aekfqgratmtadtssdraymelsslrfedtavyycatvmgkwikggydywgrgtlvtvs
sastkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d5anmd_:

Click to download the PDB-style file with coordinates for d5anmd_.
(The format of our PDB-style files is described here.)

Timeline for d5anmd_:

  • d5anmd_ is new in SCOPe 2.08-stable