SCOPe 2.06: Domain d1zpra_: 1zpr A:

Lineage for d1zpra_ (1zpr A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (67 PDB entries)

8. Domain d1zpra_: 1zpr A: [40978]
   complexed with cb3, ump; mutant

Details for d1zpra_

PDB Entry: 1zpr, 2.5 Å

PDB Description: e. coli thymidylate synthase mutant e58q in complex with cb3717 and 2'-deoxyuridine 5'-monophosphate (dump)

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1zpra_:

Sequence; same for both SEQRES and ATOM records:

>d1zpra_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihqll
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d1zpra_:

• d1zpra_ first appeared (with stable ids) in SCOP 1.55
  
• d1zpra_ appears in SCOPe 2.05
  
• d1zpra_ appears in SCOPe 2.07
  
• d1zpra_ appears in the current release, SCOPe 2.08