SCOPe 2.07: Domain d1bjga_: 1bjg A:

Lineage for d1bjga_ (1bjg A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (71 PDB entries)

8. Domain d1bjga_: 1bjg A: [40977]
   complexed with tmf, ufp; mutant

Details for d1bjga_

PDB Entry: 1bjg, 2.3 Å

PDB Description: d221(169)n mutant does not promote opening of the cofactor imidazolidine ring

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1bjga_:

Sequence; same for both SEQRES and ATOM records:

>d1bjga_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscnvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d1bjga_:

• d1bjga_ first appeared (with stable ids) in SCOP 1.55, called d1bjg__
  
• d1bjga_ appears in SCOPe 2.06
  
• d1bjga_ appears in the current release, SCOPe 2.08