SCOPe 2.08: Domain d4zsod1: 4zso D:6-218

Lineage for d4zsod1 (4zso D:6-218)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
Domain d4zsod1: 4zso D:6-218 [409766]
Other proteins in same PDB: d4zsoa1, d4zsoa2, d4zsob2, d4zsoc1, d4zsoc2, d4zsod2
automated match to d6shgh_
complexed with acy, so4

Details for d4zsod1

PDB Entry: 4zso (more details), 2.5 Å

PDB Description: crystal structure of a complex between b7-h6, a tumor cell ligand for natural cytotoxicity receptor nkp30, and an inhibitory antibody

PDB Compounds: (D:) antibody heavy chain

SCOPe Domain Sequences for d4zsod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zsod1 b.1.1.1 (D:6-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpgaelvkpgasvkmsckasgytftsynmhwvkqtpgqglewigaiypgngdtsynqkfk
gkatltadkssstaymqlssltsedsavyycareglgallrdlyywgqgtsvtvssaktt
apsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
sssvtvtsstwpsqsitcnvahpasstkvdkki

SCOPe Domain Coordinates for d4zsod1:

Click to download the PDB-style file with coordinates for d4zsod1.
(The format of our PDB-style files is described here.)

Timeline for d4zsod1: