Lineage for d4zsob1 (4zso B:6-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742891Domain d4zsob1: 4zso B:6-218 [409764]
    Other proteins in same PDB: d4zsoa1, d4zsoa2, d4zsob2, d4zsoc1, d4zsoc2, d4zsod2
    automated match to d6shgh_
    complexed with acy, so4

Details for d4zsob1

PDB Entry: 4zso (more details), 2.5 Å

PDB Description: crystal structure of a complex between b7-h6, a tumor cell ligand for natural cytotoxicity receptor nkp30, and an inhibitory antibody
PDB Compounds: (B:) antibody heavy chain

SCOPe Domain Sequences for d4zsob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zsob1 b.1.1.1 (B:6-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpgaelvkpgasvkmsckasgytftsynmhwvkqtpgqglewigaiypgngdtsynqkfk
gkatltadkssstaymqlssltsedsavyycareglgallrdlyywgqgtsvtvssaktt
apsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
sssvtvtsstwpsqsitcnvahpasstkvdkki

SCOPe Domain Coordinates for d4zsob1:

Click to download the PDB-style file with coordinates for d4zsob1.
(The format of our PDB-style files is described here.)

Timeline for d4zsob1:

  • d4zsob1 is new in SCOPe 2.08-stable