Lineage for d2bbqa_ (2bbq A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Escherichia coli [TaxId:562] [55834] (39 PDB entries) 
Domain d2bbqa_: 2bbq A: [40974]
Details for d2bbqa_
PDB Entry: 2bbq (more details), 2.3 Å
PDB Description: structural basis for recognition of polyglutamyl folates by thymidylate synthase
SCOP Domain Sequences for d2bbqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bbqa_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOP Domain Coordinates for d2bbqa_:
Click to download the PDB-style file with coordinates for d2bbqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bbqa_:
- d2bbqa_ appears in SCOP 1.57
- d2bbqa_ appears in the current release, SCOPe 2.08
View in 3D
