Lineage for d4yhyb_ (4yhy B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742543Domain d4yhyb_: 4yhy B: [409717]
    Other proteins in same PDB: d4yhyc1, d4yhyc2, d4yhyl1, d4yhyl2
    automated match to d6shgh_
    complexed with m3l

Details for d4yhyb_

PDB Entry: 4yhy (more details), 1.9 Å

PDB Description: crystal structure of 309m3-b in complex with trimethylated lys
PDB Compounds: (B:) Fab heavy chain

SCOPe Domain Sequences for d4yhyb_:

Sequence, based on SEQRES records: (download)

>d4yhyb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvetgggvvqpgrslrlsctasgftfrdywmswvrqapgkglewvadinpdgitryy
idavkgrftisrdnaksslylqmnslgaedtavyycarefhsglgwhfdlwgrgtlvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d4yhyb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvetgggvvqpgrslrlsctasgftfrdywmswvrqapgkglewvadinpdgitryy
idavkgrftisrdnaksslylqmnslgaedtavyycarefhsglgwhfdlwgrgtlvtvs
sastkgpsvfplapstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d4yhyb_:

Click to download the PDB-style file with coordinates for d4yhyb_.
(The format of our PDB-style files is described here.)

Timeline for d4yhyb_:

  • d4yhyb_ is new in SCOPe 2.08-stable