Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d4yhyb_: 4yhy B: [409717] Other proteins in same PDB: d4yhyc1, d4yhyc2, d4yhyl1, d4yhyl2 automated match to d6shgh_ complexed with m3l |
PDB Entry: 4yhy (more details), 1.9 Å
SCOPe Domain Sequences for d4yhyb_:
Sequence, based on SEQRES records: (download)
>d4yhyb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvetgggvvqpgrslrlsctasgftfrdywmswvrqapgkglewvadinpdgitryy idavkgrftisrdnaksslylqmnslgaedtavyycarefhsglgwhfdlwgrgtlvtvs sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
>d4yhyb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvetgggvvqpgrslrlsctasgftfrdywmswvrqapgkglewvadinpdgitryy idavkgrftisrdnaksslylqmnslgaedtavyycarefhsglgwhfdlwgrgtlvtvs sastkgpsvfplapstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
Timeline for d4yhyb_: