Lineage for d1bq2a_ (1bq2 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732217Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 732218Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 732219Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 732247Protein Thymidylate synthase [55833] (7 species)
  7. 732262Species Escherichia coli [TaxId:562] [55834] (52 PDB entries)
  8. 732313Domain d1bq2a_: 1bq2 A: [40971]
    complexed with po4; mutant

Details for d1bq2a_

PDB Entry: 1bq2 (more details), 2.2 Å

PDB Description: e. coli thymidylate synthase mutant n177a
PDB Compounds: (A:) Thymidylate synthase

SCOP Domain Sequences for d1bq2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq2a_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfaias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOP Domain Coordinates for d1bq2a_:

Click to download the PDB-style file with coordinates for d1bq2a_.
(The format of our PDB-style files is described here.)

Timeline for d1bq2a_: