Lineage for d1tsna_ (1tsn A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923787Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1923788Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1923789Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1923827Protein Thymidylate synthase [55833] (7 species)
  7. 1923842Species Escherichia coli [TaxId:562] [55834] (64 PDB entries)
  8. 1923912Domain d1tsna_: 1tsn A: [40970]
    complexed with c2f, po4, ufp

Details for d1tsna_

PDB Entry: 1tsn (more details), 2.2 Å

PDB Description: thymidylate synthase ternary complex with fdump and methylenetetrahydrofolate
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1tsna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tsna_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d1tsna_:

Click to download the PDB-style file with coordinates for d1tsna_.
(The format of our PDB-style files is described here.)

Timeline for d1tsna_: