| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) ![]() automatically mapped to Pfam PF02605 |
| Family f.31.1.0: automated matches [375525] (1 protein) not a true family |
| Protein automated matches [375526] (6 species) not a true protein |
| Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries) |
| Domain d4y28l_: 4y28 L: [409680] Other proteins in same PDB: d4y281_, d4y282_, d4y283_, d4y284_, d4y28a_, d4y28b_, d4y28c_, d4y28d_, d4y28e1, d4y28e2, d4y28f_, d4y28j_ automated match to d6k61l_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex |
PDB Entry: 4y28 (more details), 2.8 Å
SCOPe Domain Sequences for d4y28l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y28l_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
tyqvvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgfflvg
pfvkagplrnteiagqagslaaaglvvilsicltiygissfnegdpstapsltltgrkkq
pdqlqtadgwakftggfffggisgviwaffllyvldlpyy
Timeline for d4y28l_: