Lineage for d4y28l_ (4y28 L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027932Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 3027933Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 3027955Family f.31.1.0: automated matches [375525] (1 protein)
    not a true family
  6. 3027956Protein automated matches [375526] (6 species)
    not a true protein
  7. 3027971Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries)
  8. 3027978Domain d4y28l_: 4y28 L: [409680]
    Other proteins in same PDB: d4y281_, d4y282_, d4y283_, d4y284_, d4y28a_, d4y28b_, d4y28c_, d4y28d_, d4y28e1, d4y28e2, d4y28f_, d4y28j_
    automated match to d6k61l_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmu, lut, pqn, sf4, zex

Details for d4y28l_

PDB Entry: 4y28 (more details), 2.8 Å

PDB Description: the structure of plant photosystem i super-complex at 2.8 angstrom resolution.
PDB Compounds: (L:) Putative uncharacterized protein

SCOPe Domain Sequences for d4y28l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y28l_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
tyqvvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgfflvg
pfvkagplrnteiagqagslaaaglvvilsicltiygissfnegdpstapsltltgrkkq
pdqlqtadgwakftggfffggisgviwaffllyvldlpyy

SCOPe Domain Coordinates for d4y28l_:

Click to download the PDB-style file with coordinates for d4y28l_.
(The format of our PDB-style files is described here.)

Timeline for d4y28l_:

  • d4y28l_ is new in SCOPe 2.08-stable