Lineage for d1aiqb_ (1aiq B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Escherichia coli [TaxId:562] [55834] (39 PDB entries) 
Domain d1aiqb_: 1aiq B: [40968]
Details for d1aiqb_
PDB Entry: 1aiq (more details), 2.2 Å
PDB Description: crystal structure of thymidylate synthase r126e mutant
SCOP Domain Sequences for d1aiqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aiqb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdseriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOP Domain Coordinates for d1aiqb_:
Click to download the PDB-style file with coordinates for d1aiqb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aiqb_:
- d1aiqb_ appears in SCOP 1.57
- d1aiqb_ appears in the current release, SCOPe 2.08
View in 3D
