SCOP 1.57: Domain d1aiqa_: 1aiq A:

Lineage for d1aiqa_ (1aiq A:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family)

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (44 PDB entries)

8. Domain d1aiqa_: 1aiq A: [40967]

Details for d1aiqa_

PDB Entry: 1aiq, 2.2 Å

PDB Description: crystal structure of thymidylate synthase r126e mutant

SCOP Domain Sequences for d1aiqa_:

Sequence; same for both SEQRES and ATOM records:

>d1aiqa_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdseriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d1aiqa_:

• d1aiqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1aiqa_ appears in SCOP 1.59
  
• d1aiqa_ appears in the current release, SCOPe 2.08