Lineage for d1bq1a_ (1bq1 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. Protein Thymidylate synthase [55833] (7 species)
  7. Species Escherichia coli [TaxId:562] [55834] (70 PDB entries)
  8. Domain d1bq1a_: 1bq1 A: [40965]
    complexed with cb3, ump; mutant

Details for d1bq1a_

PDB Entry: 1bq1 (more details), 2.5 Å

PDB Description: e. coli thymidylate synthase mutant n177a in complex with cb3717 and 2'-deoxyuridine 5'-monophosphate (dump)
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1bq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq1a_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfaias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d1bq1a_ are not available.

Timeline for d1bq1a_:

Domains from other chains:
(mouse over for more information)
d1bq1b_