Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Norwalk virus [TaxId:11983] [419865] (22 PDB entries) |
Domain d4x7fb_: 4x7f B: [409641] Other proteins in same PDB: d4x7fc1, d4x7fc2, d4x7fd1, d4x7fd2 automated match to d5or7a_ complexed with edo, imd, na, po4 |
PDB Entry: 4x7f (more details), 1.7 Å
SCOPe Domain Sequences for d4x7fb_:
Sequence, based on SEQRES records: (download)
>d4x7fb_ b.121.4.0 (B:) automated matches {Norwalk virus [TaxId: 11983]} skpftlpiltlgeltnsrfplpidvlytnpnesaivqcqngrctldgelqgttqllptgi cafrgkvtqqvqdehrgthwnmtvtnlngtpfdptedvpaplgtpdfsgqiygvisqrnt ntvpgegnlpanraheaviatyspkftpklgniqfstwetqdvssgqptkftpvglasvd anshfdqwtlpsysgaltlnmnlapsvapvfpgecllffrsfiplkggygnpaidclmpq ewvqhlyqesapslsdvalvryvnpetgrtlfeaklhrngfltvarnsagpvvaptngyf rfdswvnqfytlapm
>d4x7fb_ b.121.4.0 (B:) automated matches {Norwalk virus [TaxId: 11983]} skpftlpiltlgeltnsrfplpidvlytnpnesaivqcqngrctldgelqgttqllptgi cafrgkvtqqvhrthwnmtvtnlngtpfdptedvpaplgtpdfsgqiygvisqrntlpan raheaviatyspkftpklgniqfstwetqdvssgqptkftpvglasvdanshfdqwtlps ysgaltlnmnlapsvapvfpgecllffrsfiplkggygnpaidclmpqewvqhlyqesap slsdvalvryvnpetgrtlfeaklhrngfltvarnsagpvvaptngyfrfdswvnqfytl apm
Timeline for d4x7fb_: