Lineage for d4x5za3 (4x5z A:549-588)

  1. Root: SCOPe 2.08
  2. 3048457Class l: Artifacts [310555] (1 fold)
  3. 3048458Fold l.1: Tags [310573] (1 superfamily)
  4. 3048459Superfamily l.1.1: Tags [310607] (1 family) (S)
  5. 3048460Family l.1.1.1: Tags [310682] (2 proteins)
  6. 3048461Protein C-terminal Tags [310895] (1 species)
  7. 3048462Species Synthetic [311502] (6025 PDB entries)
  8. 3052015Domain d4x5za3: 4x5z A:549-588 [409631]
    Other proteins in same PDB: d4x5za1, d4x5za2
    complexed with 3xy, dms, edo, pg4, so4

Details for d4x5za3

PDB Entry: 4x5z (more details), 1.86 Å

PDB Description: menin in complex with mi-136
PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d4x5za3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x5za3 l.1.1.1 (A:549-588) C-terminal Tags {Synthetic}
pvltfqsekmkgmkellvatkinssaiklqltaqsqvqmk

SCOPe Domain Coordinates for d4x5za3:

Click to download the PDB-style file with coordinates for d4x5za3.
(The format of our PDB-style files is described here.)

Timeline for d4x5za3:

  • d4x5za3 is new in SCOPe 2.08-stable