Lineage for d4u6vk_ (4u6v K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743019Domain d4u6vk_: 4u6v K: [409598]
    Other proteins in same PDB: d4u6va_, d4u6vb_, d4u6vl1, d4u6vl2, d4u6vm1, d4u6vm2
    automated match to d6shgh_
    complexed with so4

Details for d4u6vk_

PDB Entry: 4u6v (more details), 2.56 Å

PDB Description: Mechanisms of Neutralization of a Human Anti-Alpha Toxin Antibody
PDB Compounds: (K:) Fab, antigen binding fragment, heavy chain

SCOPe Domain Sequences for d4u6vk_:

Sequence, based on SEQRES records: (download)

>d4u6vk_ b.1.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfsshdmhwvrqatgkglewvsgigtagdtyyp
dsvkgrftisrenaknslylqmnslragdtavyycardrysptghyygmdvwgqgttvtv
ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d4u6vk_ b.1.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfsshdmhwvrqatgkglewvsgigtagdtyyp
dsvkgrftisrenaknslylqmnslragdtavyycardrysptghyygmdvwgqgttvtv
ssastkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d4u6vk_:

Click to download the PDB-style file with coordinates for d4u6vk_.
(The format of our PDB-style files is described here.)

Timeline for d4u6vk_:

  • d4u6vk_ is new in SCOPe 2.08-stable