Lineage for d4u6hc1 (4u6h C:9-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745321Domain d4u6hc1: 4u6h C:9-219 [409595]
    Other proteins in same PDB: d4u6ha2, d4u6hb2, d4u6hc2, d4u6hd2
    automated match to d6shgh_

Details for d4u6hc1

PDB Entry: 4u6h (more details), 3.1 Å

PDB Description: vaccinia l1/m12b9-fab complex
PDB Compounds: (C:) Heavy chain of murine anti-vaccinia L1 IgG2a antibody M12B9

SCOPe Domain Sequences for d4u6hc1:

Sequence, based on SEQRES records: (download)

>d4u6hc1 b.1.1.1 (C:9-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelvktgaslrmsckssgytftrfwmhwikqspgqglewigyinpstgyteynqkfkdka
tltadrssttaymqlisltsgdsavyycarsdqtnylfpywgqgtlvtvsaakttapsvy
plapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvt
vtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d4u6hc1 b.1.1.1 (C:9-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelvktgaslrmsckssgytftrfwmhwikqspgqglewigyinpstgyteynqkfkdka
tltadrssttaymqlisltsgdsavyycarsdqtnylfpywgqgtlvtvsaakttapsvy
plapvcgdttssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvtv
tsstwpsqsitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d4u6hc1:

Click to download the PDB-style file with coordinates for d4u6hc1.
(The format of our PDB-style files is described here.)

Timeline for d4u6hc1:

  • d4u6hc1 is new in SCOPe 2.08-stable