![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
![]() | Domain d4s1dh_: 4s1d H: [409571] Other proteins in same PDB: d4s1dd1, d4s1dd2, d4s1df1, d4s1df2, d4s1dl1, d4s1dl2, d4s1dp1, d4s1dp2 automated match to d6shgh_ complexed with 41m, so4 |
PDB Entry: 4s1d (more details), 2.5 Å
SCOPe Domain Sequences for d4s1dh_:
Sequence, based on SEQRES records: (download)
>d4s1dh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} evqlqqsgaelvkpgasvklsctssgfnnkdtffqwvkqrpeeglewigridpangftky dpkfqgkatitvdtssntaylqlnsltsedtalyyctrwdtygaawfaywgqgtlvtvsa akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
>d4s1dh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} evqlqqsgaelvkpgasvklsctssgfnnkdtffqwvkqrpeeglewigridpangftky dpkfqgkatitvdtssntaylqlnsltsedtalyyctrwdtygaawfaywgqgtlvtvsa akttppsvyplapgsnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl sssvtvpsstwpsetvtcnvahpasstkvdkkivpr
Timeline for d4s1dh_: