Lineage for d4s1dh_ (4s1d H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745026Domain d4s1dh_: 4s1d H: [409571]
    Other proteins in same PDB: d4s1dd1, d4s1dd2, d4s1df1, d4s1df2, d4s1dl1, d4s1dl2, d4s1dp1, d4s1dp2
    automated match to d6shgh_
    complexed with 41m, so4

Details for d4s1dh_

PDB Entry: 4s1d (more details), 2.5 Å

PDB Description: structure of igg1 fab fragment in complex with biotincytidinamide
PDB Compounds: (H:) MAB M33 FAB FRAGMENT, heavy chain

SCOPe Domain Sequences for d4s1dh_:

Sequence, based on SEQRES records: (download)

>d4s1dh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctssgfnnkdtffqwvkqrpeeglewigridpangftky
dpkfqgkatitvdtssntaylqlnsltsedtalyyctrwdtygaawfaywgqgtlvtvsa
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d4s1dh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctssgfnnkdtffqwvkqrpeeglewigridpangftky
dpkfqgkatitvdtssntaylqlnsltsedtalyyctrwdtygaawfaywgqgtlvtvsa
akttppsvyplapgsnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d4s1dh_:

Click to download the PDB-style file with coordinates for d4s1dh_.
(The format of our PDB-style files is described here.)

Timeline for d4s1dh_:

  • d4s1dh_ is new in SCOPe 2.08-stable