![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
![]() | Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) ![]() automatically mapped to Pfam PF02605 |
![]() | Family f.31.1.0: automated matches [375525] (1 protein) not a true family |
![]() | Protein automated matches [375526] (6 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries) |
![]() | Domain d4rkul_: 4rku L: [409556] Other proteins in same PDB: d4rku1_, d4rku3_, d4rku4_, d4rkua_, d4rkub_, d4rkuc_, d4rkud_, d4rkue_, d4rkuf_, d4rkuj_ automated match to d6k61l_ complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4 |
PDB Entry: 4rku (more details), 3 Å
SCOPe Domain Sequences for d4rkul_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rkul_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} sekptyqvvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgf flvgpfvkagplrnteyagaagslaaaglvvilsicltiygissfnegdpstapsltltg rkkqpdqlqtadgwakftggfffggisgviwaffllyvldlpy
Timeline for d4rkul_: