Lineage for d4rkul_ (4rku L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027932Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 3027933Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 3027955Family f.31.1.0: automated matches [375525] (1 protein)
    not a true family
  6. 3027956Protein automated matches [375526] (6 species)
    not a true protein
  7. 3027971Species Pea (Pisum sativum) [TaxId:3888] [419925] (8 PDB entries)
  8. 3027979Domain d4rkul_: 4rku L: [409556]
    Other proteins in same PDB: d4rku1_, d4rku3_, d4rku4_, d4rkua_, d4rkub_, d4rkuc_, d4rkud_, d4rkue_, d4rkuf_, d4rkuj_
    automated match to d6k61l_
    complexed with bcr, cl0, cla, dgd, g3p, lhg, lmg, lut, nex, pqn, sf4

Details for d4rkul_

PDB Entry: 4rku (more details), 3 Å

PDB Description: Crystal structure of plant Photosystem I at 3 Angstrom resolution
PDB Compounds: (L:) photosystem I reaction center subunit xi, chloroplastic

SCOPe Domain Sequences for d4rkul_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rkul_ f.31.1.0 (L:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
sekptyqvvqpingdpfigsletpvtssplvawylsnlpgyrtavnpllrgievglahgf
flvgpfvkagplrnteyagaagslaaaglvvilsicltiygissfnegdpstapsltltg
rkkqpdqlqtadgwakftggfffggisgviwaffllyvldlpy

SCOPe Domain Coordinates for d4rkul_:

Click to download the PDB-style file with coordinates for d4rkul_.
(The format of our PDB-style files is described here.)

Timeline for d4rkul_:

  • d4rkul_ is new in SCOPe 2.08-stable