Lineage for d4rdqo1 (4rdq O:9-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745255Domain d4rdqo1: 4rdq O:9-217 [409539]
    Other proteins in same PDB: d4rdqf1, d4rdqf2, d4rdqg2, d4rdqh1, d4rdqh2, d4rdqi2, d4rdqj1, d4rdqj2, d4rdqk2, d4rdql1, d4rdql2, d4rdqm2, d4rdqn1, d4rdqn2, d4rdqo2
    automated match to d6shgh_
    complexed with c6n, ca, cl, gol, k

Details for d4rdqo1

PDB Entry: 4rdq (more details), 2.85 Å

PDB Description: calcium-activated chloride channel bestrophin-1, from chicken, in complex with fab antibody fragments, chloride and calcium
PDB Compounds: (O:) Fab antibody fragment, heavy chain

SCOPe Domain Sequences for d4rdqo1:

Sequence, based on SEQRES records: (download)

>d4rdqo1 b.1.1.1 (O:9-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pelvrpgasvkmsckasgytftnywmhwvkqrpgqalewigmidpsksettlnqkfrgka
tlnvdkssntaymqlssltsedsavyycarevyyfdywgqgttltvssakttppsvypla
pgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvps
sswpsetvtcnvahpasstkvdkkivprd

Sequence, based on observed residues (ATOM records): (download)

>d4rdqo1 b.1.1.1 (O:9-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pelvrpgasvkmsckasgytftnywmhwvkqrpgqalewigmidpsksettlnqkfrgka
tlnvdkssntaymqlssltsedsavyycarevyyfdywgqgttltvssakttppsvypla
pnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpssswpse
tvtcnvahpasstkvdkkivprd

SCOPe Domain Coordinates for d4rdqo1:

Click to download the PDB-style file with coordinates for d4rdqo1.
(The format of our PDB-style files is described here.)

Timeline for d4rdqo1:

  • d4rdqo1 is new in SCOPe 2.08-stable