Lineage for d4r8wh_ (4r8w H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757635Domain d4r8wh_: 4r8w H: [409528]
    Other proteins in same PDB: d4r8wa_, d4r8wb_
    automated match to d6shgh_
    complexed with nag

Details for d4r8wh_

PDB Entry: 4r8w (more details), 2.8 Å

PDB Description: crystal structure of h7 hemagglutinin from a/anhui/1/2013 in complex with a neutralizing antibody ct149
PDB Compounds: (H:) Heavy chain of neutralizing antibody CT149

SCOPe Domain Sequences for d4r8wh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r8wh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgasvkvscktsgysfstygvswvrqapgqgpewvgwisaytgitdy
aqkfqgrvtlttdattatafldlrslrpddtatyfcardkvqgrvevgsggrhdywgqgt
lvivssa

SCOPe Domain Coordinates for d4r8wh_:

Click to download the PDB-style file with coordinates for d4r8wh_.
(The format of our PDB-style files is described here.)

Timeline for d4r8wh_:

  • d4r8wh_ is new in SCOPe 2.08-stable