SCOPe 2.06: Domain d2tsca_: 2tsc A:

Lineage for d2tsca_ (2tsc A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (67 PDB entries)

8. Domain d2tsca_: 2tsc A: [40952]
   complexed with cb3, ump

Details for d2tsca_

PDB Entry: 2tsc, 1.97 Å

PDB Description: structure, multiple site binding, and segmental accomodation in thymidylate synthase on binding d/ump and an anti-folate

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d2tsca_:

Sequence; same for both SEQRES and ATOM records:

>d2tsca_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrapesif
dyrfedfeiegydphpgikapvai

Timeline for d2tsca_:

• d2tsca_ first appeared (with stable ids) in SCOP 1.55
  
• d2tsca_ appears in SCOPe 2.05
  
• d2tsca_ appears in SCOPe 2.07
  
• d2tsca_ appears in the current release, SCOPe 2.08