Lineage for d1tsdb_ (1tsd B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212128Species Escherichia coli [TaxId:562] [55834] (67 PDB entries)
  8. 2212185Domain d1tsdb_: 1tsd B: [40949]
    complexed with bme, f89, ump

Details for d1tsdb_

PDB Entry: 1tsd (more details), 1.95 Å

PDB Description: thymidylate synthase complex with 2'-deoxyuridine 5'-monophosphate (dump) and folate analog 1843u89
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d1tsdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tsdb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d1tsdb_:

Click to download the PDB-style file with coordinates for d1tsdb_.
(The format of our PDB-style files is described here.)

Timeline for d1tsdb_: