Lineage for d1kceb1 (1kce B:2-264)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578782Species Escherichia coli [TaxId:562] [55834] (71 PDB entries)
  8. 2578817Domain d1kceb1: 1kce B:2-264 [40945]
    Other proteins in same PDB: d1kcea2, d1kceb2
    complexed with cb3, ump; mutant

Details for d1kceb1

PDB Entry: 1kce (more details), 2 Å

PDB Description: e. coli thymidylate synthase mutant e58q in complex with cb3717 and 2'-deoxyuridine 5'-monophosphate (dump)
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d1kceb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kceb1 d.117.1.1 (B:2-264) Thymidylate synthase {Escherichia coli [TaxId: 562]}
kqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihellw
flqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlkn
dpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfniasy
allvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesifd
yrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d1kceb1:

Click to download the PDB-style file with coordinates for d1kceb1.
(The format of our PDB-style files is described here.)

Timeline for d1kceb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kceb2