SCOPe 2.05: Domain d1kceb_: 1kce B:

Lineage for d1kceb_ (1kce B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (64 PDB entries)

8. Domain d1kceb_: 1kce B: [40945]
   complexed with cb3, ump; mutant

Details for d1kceb_

PDB Entry: 1kce, 2 Å

PDB Description: e. coli thymidylate synthase mutant e58q in complex with cb3717 and 2'-deoxyuridine 5'-monophosphate (dump)

PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d1kceb_:

Sequence; same for both SEQRES and ATOM records:

>d1kceb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d1kceb_:

• d1kceb_ first appeared (with stable ids) in SCOP 1.55
  
• d1kceb_ appears in SCOPe 2.04
  
• d1kceb_ is called d1kceb1 in SCOPe 2.06
  
• d1kceb_ appears in the current release, SCOPe 2.08, called d1kceb1