SCOPe 2.08: Domain d1f4ea_: 1f4e A:

Lineage for d1f4ea_ (1f4e A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (70 PDB entries)

8. Domain d1f4ea_: 1f4e A: [40941]
   complexed with gol, so4, tpr

Details for d1f4ea_

PDB Entry: 1f4e, 1.9 Å

PDB Description: crystal structure of e. coli thymidylate synthase complexed with tosyl-d-proline

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d1f4ea_:

Sequence; same for both SEQRES and ATOM records:

>d1f4ea_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d1f4ea_:

• d1f4ea_ first appeared (with stable ids) in SCOP 1.55
  
• d1f4ea_ appears in SCOPe 2.07