SCOPe 2.07: Domain d1axwb_: 1axw B:

Lineage for d1axwb_ (1axw B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (71 PDB entries)

8. Domain d1axwb_: 1axw B: [40939]
   complexed with mtx, ump

Details for d1axwb_

PDB Entry: 1axw, 1.7 Å

PDB Description: e. coli thymidylate synthase in complex with methotrexate (mtx) and 2'-deoxyuridine 5'-monophosphate (dump)

PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d1axwb_:

Sequence; same for both SEQRES and ATOM records:

>d1axwb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d1axwb_:

• d1axwb_ first appeared (with stable ids) in SCOP 1.55
  
• d1axwb_ appears in SCOPe 2.06
  
• d1axwb_ appears in the current release, SCOPe 2.08