Lineage for d1axwb_ (1axw B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Escherichia coli [TaxId:562] [55834] (39 PDB entries) 
Domain d1axwb_: 1axw B: [40939]
Details for d1axwb_
PDB Entry: 1axw (more details), 1.7 Å
PDB Description: e. coli thymidylate synthase in complex with methotrexate (mtx) and 2'-deoxyuridine 5'-monophosphate (dump)
SCOP Domain Sequences for d1axwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axwb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOP Domain Coordinates for d1axwb_:
Click to download the PDB-style file with coordinates for d1axwb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1axwb_:
- d1axwb_ appears in SCOP 1.57
- d1axwb_ appears in the current release, SCOPe 2.08
View in 3D
