Lineage for d1axwb_ (1axw B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. Protein Thymidylate synthase [55833] (7 species)
  7. Species Escherichia coli [TaxId:562] [55834] (70 PDB entries)
  8. Domain d1axwb_: 1axw B: [40939]
    complexed with mtx, ump

Details for d1axwb_

PDB Entry: 1axw (more details), 1.7 Å

PDB Description: e. coli thymidylate synthase in complex with methotrexate (mtx) and 2'-deoxyuridine 5'-monophosphate (dump)
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d1axwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axwb_ d.117.1.1 (B:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d1axwb_ are not available.

Timeline for d1axwb_:

Domains from other chains:
(mouse over for more information)
d1axwa_